PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g30252.1.p
Common NameBRADI_1g30252, LOC100828847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 283aa    MW: 30768.1 Da    PI: 8.1574
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g30252.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.5e-171055147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg+W++eEde l   v  +G ++W++I r ++ gR++k+c++rw + 
  Bradi1g30252.1.p 10 RGPWSPEEDETLRAMVGVHGARNWTAIGRGVP-GRSGKSCRLRWCNQ 55
                      89******************************.***********985 PP

2Myb_DNA-binding475.7e-1562105145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       r ++T++Ed  +v a+++ G++ W++Iar +g+gRt++ +k++w+
  Bradi1g30252.1.p  62 RRAFTADEDAAIVAAHARIGNR-WAAIARILGNGRTDNAVKNHWN 105
                       678*******************.*********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.351760IPR017930Myb domain
SuperFamilySSF466898.61E-268104IPR009057Homeodomain-like
SMARTSM007179.5E-15958IPR001005SANT/Myb domain
PfamPF002496.5E-161055IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-231163IPR009057Homeodomain-like
CDDcd001672.83E-131254No hitNo description
SMARTSM007171.0E-1261110IPR001005SANT/Myb domain
PfamPF002497.0E-1262105IPR001005SANT/Myb domain
PROSITE profilePS5129417.02462112IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-1964112IPR009057Homeodomain-like
CDDcd001676.74E-864105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGDQVGERTR GPWSPEEDET LRAMVGVHGA RNWTAIGRGV PGRSGKSCRL RWCNQLSPRV  60
ERRAFTADED AAIVAAHARI GNRWAAIARI LGNGRTDNAV KNHWNCSLKR RLRAASAGGE  120
EDERRACKRV SVSPESPSGS GSGSGSGSER SDLSHGGSVF GRRMVCRPVA ADCAMSRCRR  180
DEEEEDDGPL TSLSLSLPGM AQDQEGSFSF CHESQFQQPP SPSPAPYPFS AEFAAAMQEM  240
IRGEVRRYMA GCDDLPPPES RGFSSRSGAT NPMEWRRNGW LN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3291126108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010239722.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW13e-54MYB44_ARATH; Transcription factor MYB44
TrEMBLI1GVC20.0I1GVC2_BRADI; Uncharacterized protein
STRINGBRADI1G30252.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.12e-40myb domain protein r1